Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 89968764

Abnova™ BIRC1 Recombinant Protein

Catalog No. 89968764 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
2 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-968-764 2 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-968-764 Supplier Abnova™ Supplier No. H00004671Q01
Add to Cart
Add to Cart

Description

Used for AP, Array, ELISA, WB-Re

Sequence: LENLKLSINHKITEEGYRNFFQALDNMPNLQELDISRHFTECIKAQATTVKSLSQCVLRLPRLIRLNMLSWLLDADDIALLNVMKERHPQSKYLTILQKWILPFSPIIQK

Specifications

Accession Number NP_004527
For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blot
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH = 8.0 in the elution buffer.
Gene ID (Entrez) 4671
Molecular Weight (g/mol) 37.84 kDa
Name BIRC1 (Human) Recombinant Protein (Q01)
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue
Quantity 2 μg
Immunogen LENLKLSINHKITEEGYRNFFQALDNMPNLQELDISRHFTECIKAQATTVKSLSQCVLRLPRLIRLNMLSWLLDADDIALLNVMKERHPQSKYLTILQKWILPFSPIIQK
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias BIRC1, FLJ18088, FLJ42520, FLJ58811, NLRB1, psiNAIP
Common Name NAIP
Gene Symbol NAIP
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST
Expression System Wheat germ expression system
Form Liquid
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.