Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ BMP7 Recombinant Protein

Catalog No. 89009927 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
10 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-009-927 25 μg
89-009-926 10 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. 89-009-927 Supplier Abnova™ Supplier No. H00000655P0125
Add to Cart
Add to Cart

Human full-length ORF recombinant protein with GST-tag at N-terminal.

  • Bone morphogenetic proteins (BMPs) belongs to family of secreted signaling molecules
  • Induces ectopic bone growth
  • Molecular weight: 73.15kDa
  • Preparation method:in vitro wheat germ expression system
  • Purification: glutathione Sepharose 4 fast flow
  • Storage buffer: 50 mM Tris-HCI, 10 mM reduced glutathione
  • pH=8.0 in the elution buffer

Sequence: MHVRSLRAAAPHSFVALWAPLFLLRSALADFSLDNEVHSSFIHRRLRSQERREMQREILSILGLPHRPRPHLQGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQDSHFLTDADMVMSFVNLVEHDKEFFHPRYHHREFRFDLSKIPEGEAVTAAEFRIYKDYIRERFDNE
TFRISVYQVLQEHLGRESDLFLLDSRTLWASEEGWLVFDITATSNHWVVNPRHNLGLQLSVETLDGQSINPKLAGLIGRHGPQNKQPFMVAFFKATEVHFRSIRSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH

Best when used within three months from the date of receipt of this protein.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blot
Formulation 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molecular Weight (g/mol) 73.15
Name Human BMP7 Full-length ORF Recombinant Protein with GST-tag at N-terminal
pH Range 8
Preparation Method In vitro wheat germ expression system
Purification Method Glutathione Sepharose 4 Fast Flow
Quality Control Testing 12.5% SDS-PAGE stained with Coomassie Blue
Quantity 25 μg
Source Wheat Germ (in vitro)
Storage Requirements -80°C
Cross Reactivity Human
Recombinant Recombinant
Form Solution
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.