Learn More
CPC Scientific H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH
(Cys10 and 26 bridge) 5MG

Supplier: CPC Scientific NATR009C

Brain natriuretic peptide or B-type natriuretic peptide (BNP) (also ventricular natriuretic peptide) is a 32-amino acid peptide secreted by heart ventricles in response to excessive stretching of heart muscle cells (cardiomyocytes).SEQUENCE: H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH(Cys10 and 26 bridge)ONE-LETTER SEQUENCE: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (C10&C26 bridge)MOLECULAR FORMULA: C143H244N50O42S4MOLECULAR WEIGHT: 3464.09STORAGE CONDITIONS: -20 5 CCAS REGISTRY NUMBER: [114471-18-0]SYNONYMS: Brain Natriuretic Peptide-32 (human), Nesiritide, BNP-32 (human)RESEARCH AREA: CardiovascularREFERENCES:T. Sudoh et al., BBRC, 159, 1427 (1989)SKU(s): NATR-009A, NATR-009B, NATR-009C
The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.