Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CPC Scientific H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH
(Cys10 and 26 bridge) 5MG
SDP

Supplier:  CPC Scientific NATR009C

Encompass

Brain natriuretic peptide or B-type natriuretic peptide (BNP) (also ventricular natriuretic peptide) is a 32-amino acid peptide secreted by heart ventricles in response to excessive stretching of heart muscle cells (cardiomyocytes).SEQUENCE: H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH(Cys10 and 26 bridge)ONE-LETTER SEQUENCE: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (C10&C26 bridge)MOLECULAR FORMULA: C143H244N50O42S4MOLECULAR WEIGHT: 3464.09STORAGE CONDITIONS: -20 5 CCAS REGISTRY NUMBER: [114471-18-0]SYNONYMS: Brain Natriuretic Peptide-32 (human), Nesiritide, BNP-32 (human)RESEARCH AREA: CardiovascularREFERENCES:T. Sudoh et al., BBRC, 159, 1427 (1989)SKU(s): NATR-009A, NATR-009B, NATR-009C

Catalog No. 50-210-9857


May include imposed supplier surcharges.
Only null left
Add to Cart

Product Content Correction

The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.