Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA579571

Invitrogen™ Kininogen 1 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579571
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579571 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579571 Supplier Invitrogen™ Supplier No. PA579571
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Mouse Lung Tissue, Mouse Testis Tissue, Mouse Liver Tissue, HEPA whole cell, NEURO whole cell. IHC: mouse kidney tissue.

This gene uses alternative splicing to generate two different proteins- high molecular weight kininogen (HMWK) and low molecular weight kininogen (LMWK). HMWK is essential for blood coagulation and assembly of the kallikrein-kinin system. Also, bradykinin, a peptide causing numerous physiological effects, is released from HMWK. In contrast to HMWK, LMWK is not involved in blood coagulation. Three transcript variants encoding different isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Kininogen 1
Applications Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene KNG1
Gene Accession No. O08677
Gene Alias alpha-1-MAP; Alpha-2-thiol proteinase inhibitor; BDK; BK; Bradykinin; fitzgerald factor; high molecular weight kininogen; H-kininigen; HMWK; Ile-Ser-Bradykinin; Kallidin I; Kallidin II; kininogen; kininogen 1; kininogen 1-like 1; kininogen-1; Kininogen-1 heavy chain; Kininogen-1 light chain; Kng; Kng1; Kng1l1; L-kininogen; low molecular weight (LMW) T-kininogen II; Low molecular weight growth-promoting factor; Lysyl-bradykinin; Major acute phase protein; major acute phase protein (alpha-1-MAP); Thiostatin; T-kinin; T-kininogen 2; T-kininogen 2 heavy chain; T-kininogen 2 light chain; T-kininogen II; T-kininogen II heavy chain; T-kininogen II light chain; williams-Fitzgerald-Flaujeac factor
Gene Symbols KNG1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence in the middle region of mouse Kininogen 1 (227-259aa ECRGNLFMDINNKIANFSQSCTLYSGDDLVEA L).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 16644
Target Species Mouse
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.