Novus Biologicals™ CABLES2 Recombinant Protein Antigen

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CABLES2. Source: E.coli Amino Acid Sequence: AKFLYPTNALVTHKSDSHGLLPTPRPSVPRTLPGSRHKPAPTKSAPASTELGSDVGDTLEYNPN The CABLES2 Recombinant Protein Antigen is derived from E. coli. The CABLES2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 81928
• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Common Name: CABLES2 Recombinant Protein Antigen
• Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
• Formulation: PBS and 1M Urea, pH 7.4.
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: C20orf150, Cdk5 and Abl enzyme substrate 2, CDK5 and ABL1 enzyme substrate 2, chromosome 20 open reading frame 150, dJ908M14.2, ik3-2, Interactor with CDK3 2
• Gene Symbol: CABLES2
• Label Type: Unlabeled
• Product Type: Recombinant Protein Antigen
• Quantity: 100 μL
• Regulatory Status: RUO
• Source: E.Coli
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51760. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For Research Use Only