Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MilliporeSigma™ Calbiochem™ Psalmotoxin-1

Catalog No. 5085140001 Shop All MilliporeSigma Products
Change view
Click to view available options
Quantity:
20 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
50-851-40001 20 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 50-851-40001 Supplier MilliporeSigma™ Supplier No. 5085140001
Only null left
Add to Cart
Add to Cart

A potent proton-gated sodium channel (ASIC1a) channel blocking neurotoxin (IC50 = 0.9 nM) that can distinguish between the two ASIC1 splice variants, ASIC1a and ASIC1b.

  • Peptide Sequence: EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT (disulfide bond 3-18, 10-23, 17-33)
  • Deactivate with 5% Bleach
TRUSTED_SUSTAINABILITY

Specifications

Color White
Description 95% by HPLC
Target Proteins ASIC1a
Molecular Formula C200H312N62O57S6
Formula Weight 4689.41g/mol
Solubility H2O
Content And Storage Hygroscopic, Protect from light
Form Solid
Quantity 20 μg
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.