Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. 6031500U

Tocris Bioscience™ Calcitonin (human)
GREENER_CHOICE

Catalog No. 6031500U
Change view
Click to view available options
Quantity:
500 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
60-315-00U 500 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Catalog No. 60-315-00U Supplier Tocris Bioscience™ Supplier No. 6031/500U
Only null left
Add to Cart
Add to Cart
This item is not returnable. View return policy

Description

Endogenous calcitonin receptor agonist; inhibits bone resorption

Calcitonin (human) is an endogenous calcitonin receptor agonist. Lowers systemic blood calcium levels and inhibits bone resorption.

Specifications

Purity 0.95
CAS 21215-62-3
Content And Storage Store at −20°C
For Use With (Application) Endogenous calcitonin receptor agonist.
Lyophilized Yes
Molecular Weight (g/mol) 3417.87
Product Type Peptide
Quantity 500 μg
Sequence CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP

For Research Use Only.

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.