Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA595529

Invitrogen™ Calcitonin Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA595529
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA595529 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA595529 Supplier Invitrogen™ Supplier No. PA595529
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - IHC: mouse brain tissue, rat brain tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Calcitonin is a 32 amino acid peptide which can be demonstrated in C cells of the normal and hyperplastic thyroid. Staining for calcitonin may be used for the identification of a spectrum of C cell proliferative abnormalities ranging from C cell hyperplasia to invasive tumors. Staining for calcitonin in medullary carcinoma of the thyroid produces a fine granular pattern in the cytoplasm. Amyloid deposits within the tumor may also exhibit varying degrees of calcitonin activity.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Calcitonin
Applications Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene CALCA
Gene Accession No. P01256, P01257, P01258, P06881, P70160
Gene Alias Alpha CGRP; Alpha type CGRP; Alpha-type CGRP; CA; Cal1; CAL6; CALC; CALC1; Calca; Calcitonin; calcitonin 1; Calcitonin carboxyl-terminal peptide; calcitonin gene related peptide 1; calcitonin gene related peptide I; calcitonin gene related peptide I precursor; Calcitonin gene-related peptide; calcitonin gene-related peptide 1; Calcitonin gene-related peptide I; calcitonin precursor; calcitonin related polypeptide alpha; calcitonin/calcitonin-related polypeptide, alpha; calcitonin; calcitonin gene-related peptide 1; calcitonin-like; calcitonin-related polypeptide alpha; CCALCI; CCP; Cgrp; CGRP1; CGRP-1; CGRPI; CGRP-I; CT; Ctn; katacalcin; katacalcin (KC); KC; PCT; PDN-21; prepro-alpha-calcitonin gene-related peptide; procalcitonin; RATCAL6
Gene Symbols CALCA
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence of mouse Calcitonin (CGNLSTCMLGTYTQDLNKFHTFPQTSIGVEAP) (aa 85-116).
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 12310, 24241, 796
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.