Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CPC Scientific H-Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 5MG
SDP

Supplier:  CPC Scientific OSTP012C

Encompass

This peptide has the ability to cross mucous membranes with no significant effect on inositol phosphate accumulation.SEQUENCE: H-Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2(Cys1 and 7 bridge)ONE-LETTER SEQUENCE: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (C1&C7 bridge)MOLECULAR FORMULA: C145H240N44O48S2MOLECULAR WEIGHT: 3431.90STORAGE CONDITIONS: -20 5 CCAS REGISTRY NUMBER: [47931-85-1]SYNONYMS: Salcatonin, Salmon Calcitonin, Thyrocalcitonin (salmon)RESEARCH AREA: OsteoporosisREFERENCES:C.R. Hamilton, Am. J. Med., 56, 858 (1974)

SKU(s): OSTP-012A, OSTP-012B, OSTP-012C, OSTP-012D

Catalog No. 50-211-0019


May include imposed supplier surcharges.
Only null left
Add to Cart

Product Content Correction

The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.