Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CPC Scientific H-Val-Pro-Ile-Tyr-Glu-Lys-Lys-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu-OH (trifluoroacetate salt) 0.5MG
SDP

Supplier:  CPC Scientific CART004B

Encompass

SEQUENCE: H-Val-Pro-Ile-Tyr-Glu-Lys-Lys-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu-OH (trifluoroacetate salt)(Cys20 and 40, Cys14 and 32, Cys34 and 47 bridge)ONE-LETTER SEQUENCE: VPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL (Cys20 and 40 bridge, Cys14 and 32 bridge, Cys34 and 47 bridge)MOLECULAR FORMULA: C225H365N65O65S7MOLECULAR WEIGHT: 5245.23STORAGE CONDITIONS: -20 5 CCAS REGISTRY NUMBER: [214050-22-3]SYNONYMS: CART (55-102) (human)RESEARCH AREA: ObesityREFERENCES:Murphy KG. Brief Funct Genomic Proteomic. 2005, 4(2):95-111.SKU(s): CART-004A, CART-004B

Catalog No. 50-210-8924


May include imposed supplier surcharges.
Only null left
Add to Cart

Product Content Correction

The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.