Abnova™ CBLN4 Recombinant Protein

Human CBLN4 full-length ORF recombinant protein with GST-tag at N-terminal

Supplier:  Abnova™ H00140689P01

Catalog No. 89-015-798

Description

Cerebellin is a sixteen aa peptide found mainly in the adrenal medulla, where it has been shown to have a neuromodulatory function. Cerebellin is derived from precerebellin, a protein with sequence similarity to the noncollagen domain of complement component C1qB. The protein encoded by this gene is a glycoprotein which shares sequence similarity with precerebellin.

• Theoretical MW (kDa): 48.2
• Preparation method: In vitro wheat germ expression system
• Purification: Glutathione Sepharose 4 fast flow
• Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer

Sequence: MGSGRRALSAVPAVLLVLTLPGLPVWAQNDTEPIVLEGKCLVVCDSNPATDSKGSSSSPLGISVRAANSKVAFSAVRSTNHEPSEMSNKTRIIYFDQILVNVGNFFTLESVFVAPRKGIYSFSFHVIKVYQSQTIQVNLMLNGKPVISAFAGDKDVTREAATNGVLLYLDKEDKVYLKLEKGNLVGGWQYSTFSGFLVFPL

Best use within three months from the date of receipt of this protein.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Molecular Weight (g/mol): 48.2
• pH Range: 8
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Quantity: 10μg
• Storage Requirements: -80°C
• Recombinant: Recombinant

• Formulation: 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
• Name: Human CBLN4 Full-length ORF Recombinant Protein with GST-tag at N-terminal
• Preparation Method: In vitro wheat germ expression system
• Quality Control Testing: 12.5% SDS-PAGE stained with Coomassie Blue
• Source: Wheat Germ (in vitro)
• Cross Reactivity: Human
• Form: Solution