Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ CD26 Polyclonal Antibody

Catalog No. PIPA579165
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579165 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579165 Supplier Invitrogen™ Supplier No. PA579165

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL.

CD26 (dipeptidyl peptidase IV, DPP IV), adenosine deaminase (ADA) binding protein) is a homodimeric atypical serine protease belonging to the prolyl oligopeptidase family. CD26 is expressed on lymphocyte cells and is upregulated during T-cell activation. CD26 is also expressed on activated B cells and natural killer cells and abundantly on epithelia. CD26 is implicated in a variety of biological functions including T-cell activation, cell adhesion with extracellular matrix such as fibronectin or collagens, and in HIV infection. CD26 identical to adenosine deaminase complexing protein-2, and to the T-cell activation antigen CD26. Further, CD26 is an intrinsic membrane glycoprotein and a serine exopeptidase that cleaves X-proline dipeptides from the N-terminus of polypeptides. Alterations in CD26 peptidase activity are characteristic of malignant transformation, and the enzymatic activity increases dramatically with tumor grade and severity. CD26 is expressed in various blood cell types, but also in cells that are histogenetically related to activated fibroblasts. Alterations in CD26 density have been reported on circulating monocytes and CD4+ T cells during rheumatoid arthritis and systemic lupus erythematosus.
TRUSTED_SUSTAINABILITY

Specifications

Antigen CD26
Applications Western Blot, Immunocytochemistry
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene DPP4
Gene Accession No. P14740, P27487, P28843
Gene Alias ACT3; Activation molecule 3; ADABP; ADCP2; ADCP-2; ADCP-I; adenosine deaminase complexing protein; Adenosine deaminase complexing protein 2; bile canaliculus domain-specific membrane glycoprotein; CD26; Dipeptidyl peptidase 4; Dipeptidyl peptidase 4 60 kDa soluble form; Dipeptidyl peptidase 4 membrane form; Dipeptidyl peptidase 4 soluble form; Dipeptidyl peptidase IV; Dipeptidyl peptidase IV 60 kDa soluble form; Dipeptidyl peptidase IV membrane form; Dipeptidyl peptidase IV soluble form; dipeptidylpeptidase 4; dipeptidyl-peptidase 4; dipeptidyl-peptidase 4 (CD26, adenosine deaminase complexing protein 2); dipeptidylpeptidase IV (CD26, adenosine deaminase complexing protein 2); DPP IV; DPP4; Dpp-4; DPPIV; DPP-IV; GP110 glycoprotein; I79_016618; serine protease; T-cell activation antigen CD26; THAM; Thymocyte-activating molecule; TP103; WC10
Gene Symbols DPP4
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human CD26 (731-761aa QAMWYTDEDHGIASSTAHQHIYTHMSHFIKQ).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 13482, 1803, 25253
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.