Invitrogen™ CD36 Polyclonal Antibody

Catalog No.	Quantity
PIPA595242	100 μg

Catalog No. PIPA595242 Supplier Invitrogen™ Supplier No. PA595242

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Liver Tissue, Rat Cardiac Muscle Tissue, Mouse Liver Tissue, Mouse Cardiac Muscle Tissue, SMMC whole cell. IHC: Rat Spleen Tissue, human Lung cancer tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

CD36, also known as scavenger receptor class B member 3, is a protein that is expressed on the surface of various cell types, including macrophages, platelets, and adipocytes. It plays a role in lipid metabolism, inflammation, and atherosclerosis, and is involved in the recognition and uptake of various ligands such as oxidized low-density lipoproteins, long-chain fatty acids, and apoptotic cells. CD36 is also implicated in the pathogenesis of malaria. The protein encoded by this gene serves as a receptor for thrombospondin in platelets and various cell lines, and is the fourth major glycoprotein of the platelet surface. It binds to collagen, thrombospondin, anionic phospholipids, and oxidized LDL, and directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes. Mutations in this gene cause platelet glycoprotein deficiency. Multiple alternatively spliced transcript variants have been found for this gene. Diseases associated with CD36 include Platelet Glycoprotein IV Deficiency and Coronary Heart Disease 7.

Specifications

• Antigen: CD36
• Applications: Immunohistochemistry (Paraffin), Western Blot
• Classification: Polyclonal
• Concentration: 500 μg/mL
• Conjugate: Unconjugated
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene: CD36
• Gene Accession No.: P16671, Q07969, Q08857
• Gene Alias: adipocyte membrane protein; BDPLT10; Cd36; CD36 antigen; CD36 antigen (collagen type I receptor, thrombospondin receptor); CD36 molecule; CD36 molecule (thrombospondin receptor); CD36 protein; CHDS7; cluster determinant 36; collagen type I receptor thrombospondin receptor; collagen type I receptor, thrombospondin receptor; FAT; FAT/CD36; fatty acid translocase; fatty acid translocase/CD36; fatty acid transport protein; glycoprotein IIIb; GP3B; GP4; GPIIIB; GPIV; I79_011940; Leukocyte differentiation antigen CD36; PAS IV; PAS4; PAS-4; PAS-4 protein; PASIV; Platelet collagen receptor; Platelet glycoprotein 4; platelet glycoprotein IV; Scarb3; scavenger receptor class B, member 3; SR-B3; Thrombospondin receptor
• Gene Symbols: CD36
• Host Species: Rabbit
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human CD36 (31-66aa DLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFW).
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 12491, 29184, 948
• Target Species: Human, Mouse, Rat
• Content And Storage: -20°C
• Product Type: Antibody
• Form: Lyophilized
• Isotype: IgG