Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ CD47 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA578986
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA578986 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA578986 Supplier Invitrogen™ Supplier No. PA578986
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human MCF-7 whole cell, human SK-OV-3 whole cell, human PANC-1 whole cell.

CD47, known as integrin-associated protein (IAP), is a glycosylated transmembrane glycoprotein with five domains, expressed widely across hematopoietic cells like T and B cells, monocytes, platelets, and erythrocytes, as well as non-hematopoietic cells. It interacts with integrins such as CD51/CD61 and CD41/CD61, and serves as a receptor for thrombospondin, mediating bi-directional signaling that affects neural synaptic activity and macrophage phagocytosis. CD47 acts as a ligand for CD172a (SIRP alpha), an inhibitory receptor on macrophages, preventing phagocytosis of CD47-positive cells. This interaction influences cell migration, B cell adhesion, T cell activation, and neuronal development, particularly in synapse-rich brain and retina regions. It also modulates chondrocyte responses to mechanical signals. T cell expression of CD47 can lead to activation or apoptosis in the presence of thrombospondin. Monoclonal antibody stimulation of CD47 has been shown to induce CD4+CD25- suppressive activity and increase Foxp3 expression. CD47's role in membrane transport, signal transduction, and its broad tissue distribution highlight its significance in various physiological processes.
TRUSTED_SUSTAINABILITY

Specifications

Antigen CD47
Applications Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene CD47
Gene Accession No. Q08722
Gene Alias 9130415E20Rik; AA407862; AI848868; antigen identified by monoclonal antibody 1D8; antigenic surface determinant protein OA3; AW108519; B430305P08Rik; Cd47; CD47 antigen; CD47 antigen (Rh-related antigen, integrin-associated signal transducer); CD47 antigen/integrin-associated protein; CD47 glycoprotein; CD47 molecule; CD47/IAP; IAP; integrin associated protein; integrin-associated protein; integrin-associated signal transducer; Itgp; Leukocyte surface antigen CD47; MER6; OA3; Protein MER6; Rh-related antigen; sCD47; soluble CD 47; soluble CD47
Gene Symbols CD47
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence of human CD47 (KSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHT).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 961
Target Species Human
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.