Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CD47 Polyclonal Antibody

Supplier: Thermo Scientific PA578986

Catalog No. PIPA578986

$486.50 / Each of 1

Already have an account? Sign In to view your price. New here? Register with us today!

Qty

Add to Cart

Description

CD47 Polyclonal Antibody for Western Blot

Specifications

Antigen	CD47
Classification	Polyclonal
Conjugate	Unconjugated
Gene	CD47
Gene Alias	9130415E20Rik; AA407862; AI848868; antigen identified by monoclonal antibody 1D8; antigenic surface determinant protein OA3; AW108519; B430305P08Rik; Cd47; CD47 antigen; CD47 antigen (Rh-related antigen, integrin-associated signal transducer); CD47 antigen/integrin-associated protein; CD47 glycoprotein; CD47 molecule; CD47/IAP; IAP; integrin associated protein; integrin-associated protein; integrin-associated signal transducer; Itgp; Leukocyte surface antigen CD47; MER6; OA3; Protein MER6; Rh-related antigen; sCD47; soluble CD 47; soluble CD47
Host Species	Rabbit
Purification Method	Antigen affinity chromatography
Regulatory Status	RUO
Gene ID (Entrez)	961
Content And Storage	-20°C
Form	Lyophilized

Applications	Western Blot
Concentration	500 μg/mL
Formulation	PBS with 4mg trehalose and 0.05mg sodium azide
Gene Accession No.	Q08722
Gene Symbols	CD47
Immunogen	A synthetic peptide corresponding to a sequence of human CD47 (KSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHT).
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Human
Product Type	Antibody
Isotype	IgG

Product Suggestions Safety and Handling

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Spot an opportunity for improvement?Share a Content Correction

CD47 Polyclonal Antibody

Description

Specifications

Product Suggestions

Safety and Handling

Documents

Promotions