Novus Biologicals™ CDC40 Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Supplier:  Novus Biologicals™ NBP258541PEP

Catalog No. NBP258541PE

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDC40. Source: E.coli Amino Acid Sequence: VQYNPTYETMFAPEFGPENPFRTQQMAAPRNMLSGYAEPAHINDFMFEQQRRTFATYGYALDPSLDNHQVSAKYIGSVEEAEKNQGLTVFETGQKKT The CDC40 Recombinant Protein Antigen is derived from E. coli. The CDC40 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 51362
• Common Name: CDC40 Recombinant Protein Antigen
• Formulation: PBS and 1M Urea, pH 7.4.
• Gene Alias: Cell division cycle 40 homolog, cell division cycle 40 homolog (S. cerevisiae), cell division cycle 40 homolog (yeast), Ehb3, EH-binding protein 3, hPRP17, MGC102802, pre-mRNA splicing factor 17, pre-mRNA-processing factor 17, PRP17 homolog, PRP17EHB3PRPF
• Label Type: Unlabeled
• Quantity: 100μL
• Source: E.Coli

• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Symbol: CDC40
• Product Type: Recombinant Protein Antigen
• Regulatory Status: RUO
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51514. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For Research Use Only