Novus Biologicals™ CDK5RAP2 Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Supplier:  Novus Biologicals™ NBP258190PEP

Catalog No. NBP258190PE

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDK5RAP2. Source: E.coli Amino Acid Sequence: KLHNQEQVIKHLTESTNQKDVLLQKFNEKDLEVIQQNCYLMAAEDLELRSEGLITEKCSSQQPPGSKTIFSKEKKQSSDYEELIQVLKKEQDIYTHLVKSLQESDSINNLQAELNKIFALRKQLEQDVLSYQNLRKTLEEQISEIRRR The CDK5RAP2 Recombinant Protein Antigen is derived from E. coli. The CDK5RAP2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 55755
• Common Name: CDK5RAP2 Recombinant Protein Antigen
• Formulation: PBS and 1M Urea, pH 7.4.
• Gene Alias: C48, CDK5 activator-binding protein C48, CDK5 regulatory subunit associated protein 2, CDK5 regulatory subunit-associated protein 2, centrosomal protein 215 kDa, Centrosome-associated protein 215, Cep215, DKFZp686B1070, DKFZp686D1070, FLJ10867, KIAA1633mi
• Label Type: Unlabeled
• Quantity: 100μL
• Source: E.Coli

• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Symbol: CDK5RAP2
• Product Type: Recombinant Protein Antigen
• Regulatory Status: RUO
• Specific Reactivity: Human

For Research Use Only