Learn More
CPC Scientific H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2 (trifluoroacetate salt) 0.5MG

Supplier: CPC Scientific ATMP003A
35-residue peptide that shows activity against different tumor cell lines.ONE-LETTER SEQUENCE: KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2MOLECULAR FORMULA: C176H302N52O41S1MOLECULAR WEIGHT:3834.7STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [80451-05-4], RESEARCH AREA: AntimicrobialREFERENCES: D. Andreau et al., PNAS, 80, 6475 (1983); D. Andreau et al., Biochem., 24, 1683 (1985)
The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.