Novus Biologicals™ Carboxylesterase 1/CES1 Recombinant Protein Antigen

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CES1. The Carboxylesterase 1/CES1 Recombinant Protein Antigen is derived from E. coli. The Carboxylesterase 1/CES1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-85691. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

Specifications

• Gene ID (Entrez): 1066
• Species: Human
• Purification Method: Chromatography
• Purity: >80%
• Common Name: Carboxylesterase 1/CES1
• Concentration: 0.5mg/mL
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Formulation: PBS and 1M Urea, pH 7.4.
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: ACAT, acyl coenzyme A:cholesterol acyltransferase, Acyl-coenzyme A:cholesterol acyltransferase, Brain carboxylesterase hBr1, carboxylesterase 1, carboxylesterase 1 (monocyte/macrophage serine esterase 1), carboxylesterase 2 (liver), CEH, Ces-1, CES1A2, CES2EC 3.1.1.1, cholesteryl ester hydrolase, Cocaine carboxylesterase, EC 3.1.1, egasyn, HMSE1, HMSECES1A1, human monocyte/macrophage serine esterase 1, liver carboxylesterase 1, MGC117365, Monocyte/macrophage serine esterase, PCE-1, REH, Retinyl ester hydrolase, Serine esterase 1, Ses-1, SES1TGH, Triacylglycerol hydrolase
• Gene Symbol: CES1
• Label Type: Unlabeled
• Molecular Weight (g/mol): 32kDa
• Product Type: CES1
• Quantity: 0.1 mL
• Regulatory Status: RUO
• Source: E.Coli
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85691. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
• Immunogen: VTIFGESAGGESVSVLVLSPLAKNLFHRAISESGVALTSVLVKKGDVKPLAEQIAITAGCKTTTSAVMVHCLRQKTEEELLETTLKMKFLSLDLQGDPRESQPLLGTVIDGMLLLKTPEELQAERNFHTVP

For Research Use Only