Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIMA536233

Invitrogen™ CFL2 Monoclonal Antibody (8C13)
GREENER_CHOICE

Catalog No. PIMA536233
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIMA536233 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIMA536233 Supplier Invitrogen™ Supplier No. MA536233
Only null left
Add to Cart
Add to Cart

Description

Mouse Monoclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human U2OS whole cell, human HepG2 whole cell, human T-47D whole cell, human Raji whole cell, human placenta tissue, human A549 whole cell, rat heart tissue, rat liver tissue, rat kidney tissue, rat brain tissue, mouse heart tissue, mouse liver tissue, mouse kidney tissue, mouse brain tissue, mouse NIH/3T3 whole cell. IHC: human lung cancer tissue, human skeletal muscle tissue, mouse skeletal muscle tissue, rat skeletal muscle tissue. ICC/IF: U20S cell. Flow: A549 cell, SiHa cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Cofilin is a widely distributed intracellular actin-modulating protein that binds and depolymerizes filamentous F-actin and inhibits the polymerization of monomeric G-actin in a pH-dependent manner. It is involved in the translocation of actin-cofilin complex from cytoplasm to nucleus.
TRUSTED_SUSTAINABILITY

Specifications

Antigen CFL2
Applications Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
Classification Monoclonal
Clone 8C13
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene CFL2
Gene Accession No. P45591, Q9Y281
Gene Alias CFL2; COF2; cofilin 2; cofilin 2 (muscle); cofilin 2, muscle; cofilin, muscle isoform; Cofilin-2; HGNC:1875; NEM7; nemaline myopathy type 7
Gene Symbols CFL2
Host Species Mouse
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human Cofilin 2/CFL2 (121-153aa KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKL).
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1073, 12632, 366624
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG2b
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.