Learn More
Kingfisher Biotech Inc Chicken CCL4 Recombinant Protein

Supplier: Kingfisher Biotech Inc RP0064C025

The Chicken CCL4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken CCL4 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken CCL4 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken CCL4 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APVGSDPPTSCCFTYISRQLPFSFVADYYETNSQCPHAGVVFITRKGREVCANPENDWVQDYMNKMELN) (Gene ID: 395551). For research use only. Made in the USA
The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.