Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Kingfisher Biotech Inc Chicken TNFSF15 - 10ug
Supplier: Kingfisher Biotech Inc RPB1850C010
The Chicken TNFSF15 (TL1A; VEGI) Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken TNFSF15 (TL1A; VEGI) Biotinylated applications are for cell culture. Control. Chicken TNFSF15 (TL1A; VEGI) Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Chicken TNFSF15 (TL1A; VEGI) Biotinylated Specifications: (Molecular Weight: 19.1 kDa) (Amino Acid Sequence: ERSSHFLKQRAVAAVTDTLPSAEKPRAHLTVKKQEPSSTTGSHLPILQWEDKRGLAFTKNNLSYSSNALVIPVSGDYYVYAQVTFRGPSDTSSKTSSVTAVITKVTDSYPEPTQLLTSTKTLSEERNNWFQPIYLGAVVSLEIGDKLMVNVSDIKLVDYTKEHKTFFGAFLL) (Gene ID: 417247). For research use only. Made in the USA
missing translation for 'provideContentCorrection'
The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.
missing translation for 'productTitle'
Spot an opportunity for improvement?
missing translation for 'provideContentCorrection'