Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA595618

Invitrogen™ CHM Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA595618
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA595618 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA595618 Supplier Invitrogen™ Supplier No. PA595618
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human placenta tissue, human 293T whole cell, human A431 whole cell, human CACO-2 whole cell, human SiHa whole cell. IHC: human prostate cancer tissue, human thyroid cancer tissue, human tonsil tissue. ICC/IF: SiHa cell. Flow: U937 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Substrate-binding subunit of the Rab geranylgeranyltransferase (GGTase) complex. Binds unprenylated Rab proteins and presents the substrate peptide to the catalytic component B composed of RABGGTA and RABGGTB, and remains bound to it after the geranylgeranyl transfer reaction. The component A is thought to be regenerated by transferring its prenylated Rab back to the donor membrane. Besides, a pre-formed complex consisting of CHM and the Rab GGTase dimer (RGGT or component B) can bind to and prenylate Rab proteins; this alternative pathway is proposed to be the predominant pathway for Rab protein geranylgeranylation.
TRUSTED_SUSTAINABILITY

Specifications

Antigen CHM
Applications Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and no preservative
Gene CHM
Gene Accession No. P24386
Gene Alias CHM; CHM, Rab escort protein 1; choroideraemia protein homolog; choroideremia (Rab escort protein 1); Choroideremia protein; Choroideremia protein homolog; choroidermia; choroidermia (RAB escort protein 1); DXS540; GGTA; HSD-32; Rab escort protein 1; rab proteins geranylgeranyltransferase component A 1; REP1; REP-1; TCD; TCD protein
Gene Symbols CHM
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence of human CHM (QDQILENEEAIALSRKDKTIQHVEVFCYASQDLHED).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1121
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.