Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ CLIC1 Recombinant Protein

Catalog No. 89015730 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
10 μg
25 μg
Name:
CLIC1 (Human) Full-length ORF Recombinant Protein
CLIC1 (Human) Recombinant Protein (P01)
Human CLIC1 Full-length ORF Recombinant Protein with GST-tag at N-terminal
3 product options available for selection
Product selection table with 3 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity Name
89-015-730 10 μg CLIC1 (Human) Recombinant Protein (P01)
89-009-986 10 μg CLIC1 (Human) Full-length ORF Recombinant Protein
89-009-987 25 μg Human CLIC1 Full-length ORF Recombinant Protein with GST-tag at N-terminal
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 3 options available.
3 options
Catalog No. 89-015-730 Supplier Abnova™ Supplier No. H00001192P01
Add to Cart
Add to Cart

CLIC1 ( AAH64527.1, 1-242aa) full-length recombinant protein with GST tag

Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 1 is a member of the p64 family; the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity.

  • MW: 52.6kDa
  • Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH = 8 in elution buffer

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Accession Number AAH64527.1
For Use With (Application) Antibody Production, Protein Array, ELISA, Western Blot
Formulation 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Gene ID (Entrez) 1192
Molecular Weight (g/mol) 52.25
Name CLIC1 (Human) Recombinant Protein (P01)
pH Range 8
Preparation Method In vitro wheat germ expression system
Purification Method Glutathione Sepharose 4 Fast Flow
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 10 μg
Source Wheat Germ (in vitro)
Immunogen MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSSPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias G6/NCC27
Common Name CLIC1
Gene Symbol CLIC1
Cross Reactivity Human
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST
Form Solution
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.