Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Novus Biologicals™ CL-P1/COLEC12 Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Supplier: Novus Biologicals™ NBP258826PEP
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Colec12. Source: E.coli Amino Acid Sequence: GYKVVEKMDNVTGGMETSRQTYDDKLTAVESDLKKLGDQTGKKAISTNSELSTFRSDILDLRQQLREITEKTSKNKDTLEKLQ The Colec12 Recombinant Protein Antigen is derived from E. coli. The Colec12 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.Specifications
81035 | |
CL-P1/COLEC12 | |
PBS and 1M Urea, pH 7.4. | |
CL-P1, CLP1hCL-P1, collectin placenta 1, Collectin placenta protein 1, collectin sub-family member 12, collectin-12, Nurse cell scavenger receptor 2, SCARA4NSR2, Scavenger receptor class A member 4, scavenger receptor class A, member 4, SRCLScavenger rece | |
Unlabeled | |
100μL | |
E.coli |
>80% by SDS-PAGE and Coomassie blue staining | |
Store at −20°C. Avoid freeze-thaw cycles. | |
Blocking/Neutralizing, Control | |
COLEC12 | |
Recombinant Protein Antigen | |
RUO | |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50846. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
Provide Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only.
Spot an opportunity for improvement?
Provide Content Correction