Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Complement Factor H-related 3/CFHR3 Rabbit anti-Human, Polyclonal, R&D Systems™

Complement Factor H-related 3/CFHR3 Rabbit anti-Human, Polyclonal, R&D Systems™
SDP

Catalog No. p-7233910
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB126133 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB126133 Supplier R&D Systems Supplier No. NBP310616100UL

Customers require a valid business account associated to their profile to access pricing and ordering options.

missing translation for 'validMainframeMsg'

Description

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Complement Factor H-related 3/CFHR3 Polyclonal specifically detects Complement Factor H-related 3/CFHR3 in Human samples. It is validated for Western Blot.

Specifications

Antigen Complement Factor H-related 3/CFHR3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human FHR3. Peptide sequence FISESSSIYILNKEIQYKCKPGYATADGNSSGSITCLQNGWSAQPICINS
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10878
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Type Antibody
Form Purified
Product Line Novus
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.