Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502109160

CPC Scientific H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2 1MG
SDP

Supplier:  CPC Scientific CRFS001B

Encompass

Hypothalamic hormone that stimulates the synthesis and release of ACTH from the anterior pituitary.ONE-LETTER SEQUENCE: SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2MOLECULAR FORMULA: C208H344N60O63S2MOLECULAR WEIGHT:4757.5STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [86784-80-7], RESEARCH AREA: HormonalREFERENCES: S. Shibahara et al., The EMBO J., 2, 775 (1983)

Catalog No. 50-210-9160


May include imposed supplier surcharges.
Only null left
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.