Learn More
CPC Scientific H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2 1MG

Supplier: CPC Scientific CRFS001B

Hypothalamic hormone that stimulates the synthesis and release of ACTH from the anterior pituitary.ONE-LETTER SEQUENCE: SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2MOLECULAR FORMULA: C208H344N60O63S2MOLECULAR WEIGHT:4757.5STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [86784-80-7], RESEARCH AREA: HormonalREFERENCES: S. Shibahara et al., The EMBO J., 2, 775 (1983)
The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.