Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502109158

CPC Scientific H-Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-Gln-OH (trifluoroacetate salt) 5MG
SDP

Supplier:  CPC Scientific CRAM001B

Encompass

CRAMP is the first antibiotic peptide found in cells of myeloid lineage in the mouse, a potent antibiotic against Gram-negative bacteria.ONE-LETTER SEQUENCE: GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQMOLECULAR FORMULA: C178H302N50O46MOLECULAR WEIGHT:3878.67STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [376364-36-2], RESEARCH AREA: AntimicrobialREFERENCES: L.Saiman et al., Antimicrob. Agents Chemother., 45, 2838 (2001); P.Bergman et al., Infect. Immun., 74, 6982 (2006)

Catalog No. 50-210-9158


May include imposed supplier surcharges.
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.