Novus Biologicals™ Creatine Kinase BB Recombinant Protein Antigen

Catalog No.	Quantity
NBP184460PE	0.1 mL

Catalog No. NBP184460PE Supplier Novus Biologicals™ Supplier No. NBP184460PEP

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CKB. The Creatine Kinase BB Recombinant Protein Antigen is derived from E. coli. The Creatine Kinase BB Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-84460. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

Specifications

• Gene ID (Entrez): 1152
• Species: Human
• Protein Family: Creatine Kinase BB
• Purification Method: Chromatography
• Purity: >80% by SDS-PAGE and Coomassie blue staining
• Concentration: 0.5mg/mL
• Content And Storage: Store at -20 C. Avoid freeze-thaw cycles.
• Formulation: PBS and 1 M Urea, pH 7.4.
• For Use With (Application): Antibody Competition
• Gene Symbol: CKB
• Label Type: Unlabeled
• Molecular Weight (g/mol): M.W. (theoretical): 34 kDa
• Product Type: Creatine Kinase B
• Quantity: 0.1 mL
• Regulatory Status: RUO
• Research Category: Cancer
• Source: E.Coli
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84460. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
• Immunogen: VISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK

For Research Use Only