Abnova™ CXCL11 (Human) Recombinant Protein (P01)

Description

Human Recombinant Protein

Human CXCL11 full-length ORF ( AAH05292, 1 a.a. - 94 a.a.) recombinant protein with GST-tag at N-terminal.

Specifications

• Accession Number: AAH05292
• For Use With (Application): Antibody Production, Protein Array, ELISA, Western Blot
• Formulation: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in. the elution buffer
• Gene ID (Entrez): 6373
• Name: chemokine (C-X-C motif) ligand 11
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue
• Quantity: 2 μg
• Source: Wheat Germ (in vitro)
• Storage Requirements: Store at -80°C Aliquot to avoid repeated freezing and thawing
• Gene Alias: H174,I-TAC,IP-9,IP9,MGC102770,SCYB11,SCYB9B,b-R1
• Common Name: CXCL11
• Recombinant: Recombinant
• Sequence: MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
• Target Species Named: Human