Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ DC-SIGN (CD209) Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA578968
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA578968 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA578968 Supplier Invitrogen™ Supplier No. PA578968
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human HepG2 whole cell. IHC: human intestinal cancer tissue, human placenta tissue. Flow: THP-1 cell.

This gene encodes a transmembrane receptor and is often referred to as DC-SIGN because of its expression on the surface of dendritic cells and macrophages. The encoded protein is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens ranging from parasites to viruses with a large impact on public health. The protein is organized into three distinct domains: an N-terminal transmembrane domain, a tandem-repeat neck domain and C-type lectin carbohydrate recognition domain. The extracellular region consisting of the C-type lectin and neck domains has a dual function as a pathogen recognition receptor and a cell adhesion receptor by binding carbohydrate ligands on the surface of microbes and endogenous cells. The neck region is important for homo-oligomerization which allows the receptor to bind multivalent ligands with high avidity. Variations in the number of 23 amino acid repeats in the neck domain of this protein are rare but have a significant impact on ligand binding ability. This gene is closely related in terms of both sequence and function to a neighboring gene (GeneID 10332; often referred to as L-SIGN). DC-SIGN and L-SIGN differ in their ligand-binding properties and distribution. Alternative splicing results in multiple variants.
TRUSTED_SUSTAINABILITY

Specifications

Antigen DC-SIGN (CD209)
Applications Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene CD209
Gene Accession No. Q9NNX6
Gene Alias CD209; CD209 antigen; CD209 antigen-like protein A; CD209 molecule; Cd209a; CD209a antigen; CD209a molecule; Cd209d; CD209d antigen; CDSIGN; Cire; CLEC4L; Clec4m; C-type lectin domain family 4 member L; C-type lectin domain family 4, member L; C-type lectin domain family 4, member M; Dcsign; DC-SIGN; DC-SIGN1; Dc-signr; DC-SIGN-related protein; Dendritic cell-specific ICAM-3-grabbing non-integrin; dendritic cell-specific ICAM-3-grabbing non-integrin 1; dendritic cell-specific intercellular adhesion molecule-3-grabbing non-integrin; dendritic cell-specific intracellular adhesion molecules (ICAM)-3 grabbing non-integrin; HIV gpl20-binding protein; MGC129965; MGC130443; RGD1561104; SIGN-R1; SIGNR5
Gene Symbols CD209
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence of human DC-SIGN (MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLA).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 30835
Target Species Human
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.