Invitrogen™ DDT Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595552

Catalog No. PIPA595552

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human liver tissue, rat liver tissue, mouse liver tissue. IHC: human liver cancer tissue, mouse liver tissue, rat liver tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Tautomerization of D-dopachrome with decarboxylation to give 5,6-dihydroxyindole (DHI).

Specifications

• Antigen: DDT
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: DDT
• Gene Alias: C78655; DDCT; D-dopachrome decarboxylase; D-dopachrome tautomerase; Ddt; dopachrome isomerase; hCG_41098; phenylpyruvate tautomerase II
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 13202, 1652, 29318
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot, Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4 mg trehalose and no preservative
• Gene Accession No.: O35215, P30046, P80254
• Gene Symbols: DDT
• Immunogen: A synthetic peptide corresponding to a sequence of human DDT (EFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov