Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. Novus Biologicals™ DEFB107A Recombinant Protein Antigen

Novus Biologicals™ DEFB107A Recombinant Protein Antigen
SDP

Catalog No. NBP259792X Shop All R&D Systems Products
Change view
Click to view available options
Protein Length:
EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRT
QARTAIHRALISKRMEGHCEAECLTFEVKIGGCRAELAP
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Protein Length
NBP259792X EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRT
NBP259793X QARTAIHRALISKRMEGHCEAECLTFEVKIGGCRAELAP
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP259792X Supplier Novus Biologicals™ Supplier No. NBP259792PEP
Only null left
Add to Cart
Add to Cart

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DEFB104A The DEFB104A Recombinant Protein Antigen is derived from E. coli. The DEFB104A Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

Protein Length EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRT
Purification Method >80% by SDS-PAGE and Coomassie blue staining
Common Name DEFB104A Recombinant Protein Antigen
Content And Storage Store at −20°C. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4
For Use With (Application) AC
Gene Alias DEFB104B, DEFB-4, defensin
Gene Symbol DEFB104A
Label Type Unlabeled
Product Type Recombinant Protein Antigen
Quantity 0.1 mL
Regulatory Status RUO
Source E.coli
Specific Reactivity Human
Show More Show Less

For Research Use Only.

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.