Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CPC Scientific H-Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys-OH (trifluoroacetate salt) 0.1MG
Supplier: CPC Scientific DEFS002A
Endogenous antibiotic peptide that exhibits a range of prominent anti-microbial activities against bacteria, fungi, and certain enveloped viruses.SEQUENCE: H-Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys-OH (trifluoroacetate salt)(Cys2 and 30 bridge, Cys4 and 19 bridge, Cys 9 and 29 bridge)ONE-LETTER SEQUENCE: ACYCRIPACIAGERRYGTCIYQGRLWAFCC (C2&C30 bridge, C4&C19 bridge, C 9&C29 bridge)MOLECULAR FORMULA: C150H222N44O38S6MOLECULAR WEIGHT: 3442.08STORAGE CONDITIONS: -20 5 CCAS REGISTRY NUMBER: [148093-65-6]SYNONYMS: -Defensin-1 (Human), alpha-Defensin-1 (Human), Defensin HNP-1 human, Human Neutrophil Peptide-1, HNP-1RESEARCH AREA: AntimicrobialREFERENCES:T. Ganz et al., J. Clin. Invest., 76, 1427 (1985)M.E. Selsted et al., J. Clin. Invest., 76, 1436 (1985)T. Ganz et al., Eur. J. Haematol, 44, 1 (1990)SKU(s): DEFS-002A, DEFS-002B
Product Content Correction
The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction