Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. NBP255333PE

Novus Biologicals™ DNMBP Recombinant Protein Antigen
SDP

Catalog No. NBP255333PE Shop All Novus Biologicals Products
Click to view available options
Quantity:
100 μL

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DNMBP. Source: E.coli Amino Acid Sequence: GVEWEMPLATDSPTSDPTEVVNGISSQPQVPFHPNLQKSQYYSTVGGSHPHSEQYPDLLPLEARTRDYASLPPKRMYSQL The DNMBP Recombinant Protein Antigen is derived from E. coli. The DNMBP Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

Gene ID (Entrez) 23268
Purification Method >80% by SDS-PAGE and Coomassie blue staining
Common Name DNMBP Recombinant Protein Antigen
Content And Storage −20°C, avoid freeze-thaw cycles
Formulation PBS and 1M Urea, pH 7.4
For Use With (Application) Blocking/Neutralizing, Control
Gene Alias dynamin binding protein, dynamin-binding protein, KIAA1010ARHGEF36, Scaffold protein Tuba, TUBA
Gene Symbol DNMBP
Label Type Unlabeled
Product Type Recombinant Protein Antigen
Quantity 100 μL
Regulatory Status RUO
Source E.coli
Specific Reactivity This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52236. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Show More Show Less

For research use only.

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.