Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA579182

Invitrogen™ E2F4 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579182
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579182 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579182 Supplier Invitrogen™ Supplier No. PA579182
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: HELA whole cell, U20S whole cell, MCF-7 whole cell. IHC: mouse intestine tissue, rat intestine tissue, human intetsinal cancer tissue.

E2F transcription factors are functionally regulated by binding to Rb p110, p107, and p130. E2F-4 is regulated by complex formation with Rb p110. E2F family members bind DNA as heterodimers with members of the DP family of polypeptides Differential phosphorylation contributes to the microheterogeniety of E2F-4 (total aa 411-416, varies due to a trinucleotide repeat).
TRUSTED_SUSTAINABILITY

Specifications

Antigen E2F4
Applications Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene E2f4
Gene Accession No. Q16254, Q8R0K9
Gene Alias 2010111M04Rik; AI427446; E2F transcription factor 4; E2F transcription factor 4, p107/p130-binding; E2F4; E2F-4; p107/p130-binding protein; transcription factor E2F4
Gene Symbols E2f4
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human E2F4 (106-144aa ELQQREQELDQHKVWVQQSIRNVTEDVQNSCLAYVTHED).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 100360427, 104394, 1874
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.