Invitrogen™ EEF2 Monoclonal Antibody (5F5)

Mouse Monoclonal Antibody

Supplier:  Invitrogen™ MA549171

Catalog No. PIMA549171

Description

Adding 0.2 mL of distilled water will yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human HEPG2 whole cell, human Jurkat whole cell, human U20S whole cell, rat PC-12 whole cell, mouse NIH/3T3 whole cell. IHC: human breast cancer tissue, human rectal cancer tissue, human liver cancer tissue, human rectal cancer tissue. ICC/IF: HEPG2 cell. Flow: HEPA1-6 cell, HL-60 cell, NRK cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (PRE) to the post-translocational (POST) state as the newly formed A-site-bound peptidyl-tRNA and P-site-bound deacylated tRNA move to the P and E sites, respectively. Catalyzes the coordinated movement of the two tRNA molecules, the mRNA and conformational changes in the ribosome.

Specifications

• Antigen: EEF2
• Classification: Monoclonal
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and no preservative
• Gene Accession No.: P05197, P13639, P58252
• Gene Symbols: EEF2
• Immunogen: A synthetic peptide corresponding to a sequence of human EEF2 (QTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQR).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG1

• Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
• Clone: 5F5
• Conjugate: Unconjugated
• Gene: EEF2
• Gene Alias: EEF2; EEF-2; Ef2; EF-2; Elongation factor 2; elongation factor-2; eukaryotic translation elongation factor 2; I79_013848; polypeptidyl-tRNA translocase; SCA26; zef2
• Host Species: Mouse
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 13629, 1938, 29565
• Content And Storage: -20°C
• Form: Lyophilized