Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ ELF5 Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Manufacturer:  Novus Biologicals™ NBP257358PEP

Catalog No. NBP257358PE

Add to cart



A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ELF5. Source: E.coli Amino Acid Sequence: QDCHSHSRTSLQSSHLWEFVRDLLLSPEENCGILEWEDREQGIFRVVKSEALAKMW The ELF5 Recombinant Protein Antigen is derived from E. coli. The ELF5 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.


Blocking/Neutralizing, Control
>80% by SDS-PAGE and Coomassie blue staining
PBS and 1M Urea, pH 7.4.
ELF5 Recombinant Protein Antigen
Store at −20°C. Avoid freeze-thaw cycles.
E74-like factor 5, E74-like factor 5 (ets domain transcription factor), Epithelium-restricted ESE-1-related Ets factor, Epithelium-specific Ets transcription factor 2, ESE2ESE-2, ETS-related transcription factor Elf-5
Recombinant Protein Antigen
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only.