Novus Biologicals™ Endostatin Recombinant Protein Antigen

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Endostatin. Source: E.coli Amino Acid Sequence: VRLWATRQAMLGQVHEVPEGWLIFVAEQEELYVRVQNGFRKVQLEARTPLPRGTDNEVAALQPPVVQLHDSN The Endostatin Recombinant Protein Antigen is derived from E. coli. The Endostatin Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 80781
• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Common Name: Endostatin Recombinant Protein Antigen
• Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
• Formulation: PBS and 1M Urea, pH 7.4
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: antiangiogenic agent, collagen alpha-1(XVIII) chain, collagen, type XVIII, alpha 1, FLJ27325, FLJ34914, human type XVIII collagen10endostatin, KNO, KNO1MGC74745, Knobloch syndrome, type 1, KS, multi-functional protein MFP
• Gene Symbol: COL18A1
• Label Type: Unlabeled
• Product Type: Recombinant Protein Antigen
• Quantity: 100 μL
• Regulatory Status: RUO
• Source: E.coli
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51286. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For research use only.