Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA579222

Invitrogen™ ETS1 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579222
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579222 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579222 Supplier Invitrogen™ Supplier No. PA579222
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: NIH3T3 whole cell, A375 whole cell.

ETS1 (c-Ets-1; v-ets erythroblastosis virus E26 oncogene homlog 1 (avian); ETS-1; EWSR2; p54), a 441 A. A protein, is a member of DNA-binding ETS protein family. It is a multifunctional protein consisting of an N-terminal pointed domain, a central transactivation domain and 2 auto inhibitory domains flanked on both sides of conserved C-terminal Ets domain. It interacts with factors including PEBP2alphaA, p300/CBP and mediates transactivation of Osteopontin, Presenilin-1, Stromelysin and Collagenase. It is activated by Ras/MAPK signaling and its expression is up-regulated in resting T-cells. Its activity is modulated by various factors including AP-1, Sp-1, c-myb and MafB. Sp100 activates ETS1 in nuclear bodies. It interacts with EAP1/Daxx and causes repression of MMP1 and BCL2 transactivation. It interacts with STAT6 and modulates Socs-1 expression induced by IL-4. It interacts with GATA3 and positively regulates Tax-1 dependent IL-5 expression.
TRUSTED_SUSTAINABILITY

Specifications

Antigen ETS1
Applications Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene ETS1
Gene Accession No. P14921, P27577
Gene Alias AI196000; AI448617; Avian erythroblastosis virus E26 (v-ets) oncogene homolog-1; avian erythroblastosis virus E26 oncogene 1; c-ets protein; c-ets1; c-ets-1; c-ets-1 oncogene; c-ets-1 protein; c-ets-alpha; c-ets-beta; D230050P06; E26 avian leukemia oncogene 1, 5' domain; Ets avian erythroblastosis virus E2 oncogene homolog 1 (tumor progression locus 1); ets protein; ETS proto-oncogene 1, transcription factor; Ets1; ETS-1; ETS-1A; ETS-1B; Ets-1Delta(III-VI); Etsoncb; EWSR2; FLJ10768; oncoprotein; p54; p54 transcription factor; protein C-ets-1; TNFAIP3 interacting protein 1; TNIP1; Tpl1; transforming protein p54/c-ets-1; transforming protein p68/c-ets-1; tumor progression locus 1; unnamed protein product; v-ets avian erythroblastosis virus E2 oncogene homolog 1; v-ets avian erythroblastosis virus E26 oncogene homolog 1; v-ets erythroblastosis virus E26 oncogene homolog 1; virion-associated nuclear-shuttling protein
Gene Symbols ETS1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human ETS1 (67-98aa KDPRQWTETHVRDWVMWAVNEFSLKGVDFQKF).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2113, 23871
Target Species Human, Mouse
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.