Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502109269

CPC Scientific H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 (trifluoroacetate salt) 0.5MG
SDP

Supplier:  CPC Scientific EXED005A

Encompass

A new member of the Glucagon superfamily that was originally isolated from the venom of the lizard, Heloderma Horridum. At low concentrations, it interacts with putative exendin receptors causing an increase in pancreatic acinar cAMP, while at higher concentrations it interacts with VIP receptors to stimulate an increase in cellular cAMP and amylase release. ONE-LETTER SEQUENCE: HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2MOLECULAR FORMULA: C184H282N50O61S1MOLECULAR WEIGHT:4202.63STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [130357-25-4], RESEARCH AREA: DiabetesREFERENCES: J. Eng et al., J. Biol. Chem., 267, 7402 (1992)

Catalog No. 50-210-9269


May include imposed supplier surcharges.
Only null left
Add to Cart

Product Content Correction

The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.