Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502109265

CPC Scientific H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 0.5MG
SDP

Supplier:  CPC Scientific EXED003A

Encompass

Exendin-4 (Exenatide), originally isolated from Heloderma suspectum venom, stimulates acinar cAMP without causing amylase release, binds with similar affinity to the glucagon-like peptide 1 receptor, and is used in the treatment of type 2 diabetes.SEQUENCE: H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2ONE-LETTER SEQUENCE: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2MOLECULAR FORMULA: C184H282N50O60S1MOLECULAR WEIGHT: 4186.7STORAGE CONDITIONS: -20 5 CCAS REGISTRY NUMBER: [141758-74-9]SYNONYMS: ExenatideRESEARCH AREA: DiabetesREFERENCES:J. Eng et al., J. Biol. Chem., 267(11), 7402 (1992)SKU(s): EXED-003A, EXED-003B

Catalog No. 50-210-9265


May include imposed supplier surcharges.
Only null left
Add to Cart

Product Content Correction

The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.