Invitrogen™ FABP4 Monoclonal Antibody (10E12)

Catalog No.	Quantity
PIMA549201	100 μg

Catalog No. PIMA549201

Supplier: Invitrogen™ MA549201

Description

Mouse Monoclonal Antibody

Adding 0.2 mL of distilled water will yield a concentration of 500 μg/mL. Immunogen sequence is identical to the related mouse and rat sequences. Positive Control - WB: human RT4 whole cell, human HL-60 whole cell, rat thymus tissue, mouse thymus tissue. IHC: human renal clear cell carcinoma tissue, human gall bladder adenosquamous carcinoma tissue, human gastric cancer tissue, human lymphadenoma tissue, rat intestines tissue, mouse intestines tissue, mouse intestines tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

FABP4 belongs to the fatty acid binding protein (FABP) family. FABPs contribute to the transport of fatty acids and other lipids in various cellular pathways. FABP4 is expressed in adipocytes, macrophages, monocyte-derived dendritic cells, and myoepithelial cells. It delivers long-chain fatty acids and retinoic acid to their cognate receptors in the nucleus.

Specifications

• Antigen: FABP4
• Applications: Immunohistochemistry (Paraffin), Western Blot
• Classification: Monoclonal
• Clone: 10E12
• Concentration: 500 μg/mL
• Conjugate: Unconjugated
• Formulation: PBS with 4mg trehalose and no preservative
• Gene: FABP4
• Gene Accession No.: P04117, P15090, P70623
• Gene Alias: 3T3-L1 lipid-binding protein; 422/aP2; adipocyte fatty acid binding protein; Adipocyte lipid binding protein; adipocyte lipid-binding protein; adipocyte protein aP2; adipocyte-type fatty acid-binding protein; AFABP; A-FABP; ALBP; ALBP/Ap2; Ap2; epididymis secretory protein Li 104; FABP4; fatty acid binding protein 4; Fatty acid binding protein 4 adipocyte; fatty acid binding protein 4, adipocyte; fatty acid-binding protein 4; Fatty acid-binding protein, adipocyte; HEL S 104; HEL-S-104; Lbpl; myelin P2 protein homolog; P15; P2 adipocyte protein; Protein 422
• Gene Symbols: FABP4
• Host Species: Mouse
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human FABP4 (10-40aa KLVSSENFDDYMKEVGVGFATRKVAGMAKPN).
• Purification Method: Antigen affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 11770, 2167, 79451
• Target Species: Human, Mouse, Rat
• Content And Storage: -20°C
• Product Type: Antibody
• Form: Lyophilized
• Isotype: IgG1