Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ FABP4 Monoclonal Antibody (10E12)
GREENER_CHOICE

Catalog No. PIMA549201
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIMA549201 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIMA549201 Supplier Invitrogen™ Supplier No. MA549201
Only null left
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

Adding 0.2 mL of distilled water will yield a concentration of 500 μg/mL. Immunogen sequence is identical to the related mouse and rat sequences. Positive Control - WB: human RT4 whole cell, human HL-60 whole cell, rat thymus tissue, mouse thymus tissue. IHC: human renal clear cell carcinoma tissue, human gall bladder adenosquamous carcinoma tissue, human gastric cancer tissue, human lymphadenoma tissue, rat intestines tissue, mouse intestines tissue, mouse intestines tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

FABP4 belongs to the fatty acid binding protein (FABP) family. FABPs contribute to the transport of fatty acids and other lipids in various cellular pathways. FABP4 is expressed in adipocytes, macrophages, monocyte-derived dendritic cells, and myoepithelial cells. It delivers long-chain fatty acids and retinoic acid to their cognate receptors in the nucleus.
TRUSTED_SUSTAINABILITY

Specifications

Antigen FABP4
Applications Immunohistochemistry (Paraffin), Western Blot
Classification Monoclonal
Clone 10E12
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and no preservative
Gene FABP4
Gene Accession No. P04117, P15090, P70623
Gene Alias 3T3-L1 lipid-binding protein; 422/aP2; adipocyte fatty acid binding protein; Adipocyte lipid binding protein; adipocyte lipid-binding protein; adipocyte protein aP2; adipocyte-type fatty acid-binding protein; AFABP; A-FABP; ALBP; ALBP/Ap2; Ap2; epididymis secretory protein Li 104; FABP4; fatty acid binding protein 4; Fatty acid binding protein 4 adipocyte; fatty acid binding protein 4, adipocyte; fatty acid-binding protein 4; Fatty acid-binding protein, adipocyte; HEL S 104; HEL-S-104; Lbpl; myelin P2 protein homolog; P15; P2 adipocyte protein; Protein 422
Gene Symbols FABP4
Host Species Mouse
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human FABP4 (10-40aa KLVSSENFDDYMKEVGVGFATRKVAGMAKPN).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 11770, 2167, 79451
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.