Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Abnova™ Feline CXCL12 (beta) Recombinant Protein
Used for Func, SDS-PAGE
Supplier: Abnova™ P4854
Description
Sequence: KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKMSpecifications
O62657-2 | |
Lyophilized | |
8.5kDa | |
Escherichia coli expression system | |
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM | |
RUO | |
SDF-1 | |
CXCL12 | |
E. coli | |
None | |
Lyophilized |
Functional Study, SDS-PAGE | |
493806 | |
CXCL12 (Beta) (Cat) Recombinant protein | |
10 ug | |
Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing. | |
<0.1 EU/μg | |
CXCL12 | |
The activity is determined by the ability to chemoattract human peripheral T cells activated with PHA and IL-2, is typically in the range of 10-75ng/mL. | |
Recombinant | |
Escherichia coli expression system |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction