Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 89941047

Abnova™ Feline CXCL12 (beta) Recombinant Protein

Catalog No. 89941047 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
10 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-941-047 10 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-941-047 Supplier Abnova™ Supplier No. P4854
Add to Cart
Add to Cart

Description

Used for Func, SDS-PAGE

Sequence: KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM

Specifications

Accession Number O62657-2
For Use With (Application) Functional Study, SDS-PAGE
Formulation Lyophilized
Gene ID (Entrez) 493806
Molecular Weight (g/mol) 8.5kDa
Name CXCL12 (Beta) (Cat) Recombinant protein
Preparation Method Escherichia coli expression system
Quantity 10 μg
Immunogen KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
Storage Requirements Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Endotoxin Concentration <0.1 EU/μg
Gene Alias SDF-1
Common Name CXCL12
Gene Symbol CXCL12
Biological Activity The activity is determined by the ability to chemoattract human peripheral T cells activated with PHA and IL-2, is typically in the range of 10-75ng/mL.
Species E. coli
Recombinant Recombinant
Protein Tag None
Expression System Escherichia coli expression system
Form Lyophilized
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.