Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FGF-21 Antibody, Novus Biologicals™
SDP

Catalog No. NB439354 Shop All Novus Biologicals Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB439354 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB439354 Supplier Novus Biologicals Supplier No. NBP1592910.1ML
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

FGF-21 Polyclonal specifically detects FGF-21 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin), Simple Western, Western Blot.

Specifications

Antigen FGF-21
Applications Immunohistochemistry, Immunohistochemistry (Paraffin), Simple Western, Western Blot
Classification Polyclonal
Concentration 0.5 mg/mL
Conjugate Unconjugated
Dilution Western Blot 0.2-1 μg/mL, Simple Western 1:100, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS, 2% Sucrose
Gene Accession No. Q9NSA1
Gene Alias FGF-21, fibroblast growth factor 21
Host Species Rabbit
Immunogen Synthetic peptides corresponding to FGF21(fibroblast growth factor 21) The peptide sequence was selected from the N terminal of FGF21 (NP_061986). Peptide sequence DSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYT.
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Angiogenesis, Cancer
Primary or Secondary Primary
Gene ID (Entrez) 26291
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.