Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 89968777

Abnova™ FGF2 (Human) Recombinant Protein

Catalog No. 89968777 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
2 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-968-777 2 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-968-777 Supplier Abnova™ Supplier No. H00002247Q01
Add to Cart
Add to Cart

Description

Human FGF2 partial ORF ( NP_001997, 189 a.a. - 288 a.a.) recombinant protein with GST-tag at N-terminal.

  • Sequence: SDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Specifications

Accession Number NP_001997
Gene ID (Entrez) 2247
Name fibroblast growth factor 2 (basic)
Preparation Method Wheat germ expression system
Quality Control Testing 125% SDS-PAGE Stained with Coomassie Blue
Quantity 2 μg
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias BFGF, FGFB, HBGF-2
Gene Symbol FGF2
Species Wheat Germ (in vitro)
Protein Tag GST
Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.