Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA5114364

Invitrogen™ Fibrinogen alpha chain Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA5114364
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA5114364 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA5114364 Supplier Invitrogen™ Supplier No. PA5114364
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat skeletal muscle tissue, HEPG2 whole cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Fibrinogen is a soluble protein found in blood plasma and is produced by the liver cells. The protein is a hexamer consisting of two sets of disulfide linked chains. Fibrinogen is essential for blood coagulation as the precursor of fibrin. It is converted to fibrin by the action of thrombin in the presence of calcium ions.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Fibrinogen alpha chain
Applications Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene Fga
Gene Accession No. P02671, P06399
Gene Alias Ac1873; ENSMUSG00000059807; Fba5e; Fga; Fib; Fib2; Fibrinogen a chain; Fibrinogen alpha; Fibrinogen alpha chain; Fibrinogen α chain; fibrinogen, A alpha polypeptide; fibrinogen, alpha polypeptide; Fibrinogenα chain; Fibrinopeptide A
Gene Symbols Fga
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human FGA (687-727aa RTWQDYKRGFGSLNDEGEGEFWLGNDYLHLLTQRGSVLRVE).
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2243, 361969
Target Species Human, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.