Novus Biologicals™ Flt-3/Flk-2/CD135 Recombinant Protein Antigen

Catalog No.	Quantity
NBP257187PE	100 μL

Catalog No. NBP257187PE Supplier Novus Biologicals™ Supplier No. NBP257187PEP

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Flt-3/Flk-2/CD135. Source: E.coli Amino Acid Sequence: PGIPVDANFYKLIQNGFKMDQPFYATEEIYIIMQSCWAFDSRKRPSFPNLTSFLGCQLADAEEAMYQNVDGRVSECPHTYQNRRPFSREMDLGLLS The Flt-3/Flk-2/CD135 Recombinant Protein Antigen is derived from E. coli. The Flt-3/Flk-2/CD135 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 2322
• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Common Name: Flt-3/Flk-2/CD135 Recombinant Protein Antigen
• Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
• Formulation: PBS and 1M Urea, pH 7.4.
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: CD135, CD135 antigen, EC 2.7.10, fetal liver kinase 2, FL cytokine receptor, FLK2, FLT-3, FLT3 receptor tyrosine kinase, Fms-like tyrosine kinase 3, fms-related tyrosine kinase 3, growth factor receptor tyrosine kinase type III, Stem cell tyrosine kinase
• Gene Symbol: FLT3
• Label Type: Unlabeled
• Product Type: Recombinant Protein Antigen
• Quantity: 100 μL
• Regulatory Status: RUO
• Source: E.coli
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51532. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For Research Use Only.