Invitrogen™ FMO1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595285

Catalog No. PIPA595285

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human hepatocellular carcinoma tumor tissue, human HepG2 whole cell, human HUH7 whole cell, rat liver tissue, mouse liver tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2 found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region. Flavin-containing monooxygenases are NADPH-dependent flavoenzymes that catalyzes the oxidation of soft nucleophilic heteroatom centers in drugs, pesticides, and xenobiotics.

Specifications

• Antigen: FMO1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: FMO1
• Gene Alias: dimethylaniline monooxygenase [N-oxide-forming] 1; Dimethylaniline oxidase 1; fetal hepatic flavin-containing monooxygenase 1; flavin containing dimethylaniline monoxygenase 1; flavin containing monooxygenase 1; Flavin-containing monooxygenase 1; Flavin-containing monooxygenase 1 (fetal liver); FMO 1; FMO 1A1; FMO form 1; Fmo1; Fmo-1; hepatic flavin-containing monooxygenase (EC 1.14.13.8); hepatic flavin-containing monooxygenase (FMO); hepatic flavin-containing monooxygenase 1; monooxygenase (FMO) (EC 1.14.13.8); RFMO1A
• Host Species: Rabbit
• Purification Method: Affinity Chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 14261, 2326, 25256
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and no preservative
• Gene Accession No.: P36365, P50285, Q01740
• Gene Symbols: FMO1
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human FMO1 (334-363aa AFPFLDESVVKVEDGQASLYKYIFPAHLQK).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG