Invitrogen™ FMRP Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579278

Catalog No. PIPA579278

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human 293T whole cell, human Jurkat whole cell, human K562 whole cell, rat brain tissue, rat liver tissue, mouse brain tissue, mouse liver tissue. IHC: human seminoma testis tissue. ICC/IF: Hela cell.

FMR1 binds RNA and is associated with polysomes. The protein may be involved in mRNA trafficking from the nucleus to the cytoplasm. A trinucleotide repeat in the 5' UTR is normally found at 6-53 copies, but an expansion to 55-230 repeats is the cause of fragile X syndrome. Expansion of the trinucleotide repeat may also cause one form of premature ovarian failure. Multiple alternatively spliced transcript variants that encode different protein isoforms and which are located in different cellular locations have been described for this gene.

Specifications

• Antigen: FMRP
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: FMR1
• Gene Alias: AT24755; BcDNA:GM08679; cg 6203 gene product from transcript cg6203-rc; cg6203; CG6203-PA; CG6203-PB; CG6203-PC; CG6203-PD; CG6203-PE; CG6203-PF; CG6203-PG; CG6203-PH; CG6203-PI; CG6203-PJ; CG6203-PK; dFMR; DFmr1; dFmrp; dfxr; dfxr1; dFXRP; Dmel\CG6203; Dmel_CG6203; dmfr1; drosophila fragile X mental retardation protein; EP(3)3517; FMR; FMR1; Fmr-1; Fmr1-PA; Fmr1-PB; Fmr1-PC; Fmr1-PD; Fmr1-PE; Fmr1-PF; Fmr1-PG; Fmr1-PH; Fmr1-PI; Fmr1-PJ; Fmr1-PK; FMRP; FMRP translational regulator 1; fragile X; fragile X mental retardation; fragile X mental retardation 1; fragile X mental retardation gene; fragile X mental retardation protein; fragile X mental retardation protein 1; Fragile X mental retardation protein 1 homolog; fragile X mental retardation related 1; fragile X mental retardation syndrome 1; fragile X mental retardation syndrome 1 homolog; Fragile X mental retardation syndrome-related protein 1; fragile X mental retardation-1 protein; fragile X protein; fragile x related; fragile X related protein; fragile X retardation 1 protein; fragile X-related; fragile-X; Fragile-X mental retardation 1; Fragile-X mental retardation protein; Fragile-X-related; FRAXA; FXR; MGC87458; POF; POF1; protein FMR-1; ragile X mental retardation protein; synaptic functional regulator FMR1
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 14265, 2332, 24948
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: P35922, Q06787, Q80WE1
• Gene Symbols: FMR1
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human FMRP (164-200aa ENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIM).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov