Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ GAP-43 Recombinant Protein Antigen
SDP

Catalog No. p-7112710 Shop All R&D Systems Products
Change view
Click to view available options
Protein Length:
KEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDE
SFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKA
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Protein Length
NBP254668X KEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDE
NBP254671X SFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKA
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP254668X Supplier Novus Biologicals™ Supplier No. NBP254668PEP
Only null left
Add to Cart
Add to Cart

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GAP-43 The GAP-43 Recombinant Protein Antigen is derived from E. coli. The GAP-43 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

Gene ID (Entrez) 2596
Protein Length KEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDE
Purification Method >80% by SDS-PAGE and Coomassie blue staining
Common Name GAP43 Recombinant Protein Antigen
Content And Storage Store at −20°C. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4
For Use With (Application) Blocking/Neutralizing, Control
Gene Alias Axonal membrane protein GAP-43, B-50, Basp2, calmodulin-binding protein P-57, GAP43, GAP-43, growth associated protein 43, Growth-associated protein 43
Gene Symbol GAP43
Label Type Unlabeled
Molecular Weight (g/mol) 24 kDa
Product Type Recombinant Protein Antigen
Quantity 0.1mL
Regulatory Status RUO
Source E.coli
Specific Reactivity Human
Show More Show Less

For Research Use Only.

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.