Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Novus Biologicals™ GAP-43 Recombinant Protein Antigen
Shop All Novus Biologicals Products
Click to view available options
Protein Length:
KEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDE
SFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKA
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GAP-43 The GAP-43 Recombinant Protein Antigen is derived from E. coli. The GAP-43 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Specifications
Specifications
| Gene ID (Entrez) | 2596 |
| Protein Length | KEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDE |
| Purification Method | >80% by SDS-PAGE and Coomassie blue staining |
| Common Name | GAP43 Recombinant Protein Antigen |
| Content And Storage | Store at −20°C. Avoid freeze-thaw cycles. |
| Formulation | PBS and 1M Urea, pH 7.4 |
| For Use With (Application) | Blocking/Neutralizing, Control |
| Gene Alias | Axonal membrane protein GAP-43, B-50, Basp2, calmodulin-binding protein P-57, GAP43, GAP-43, growth associated protein 43, Growth-associated protein 43 |
| Gene Symbol | GAP43 |
| Label Type | Unlabeled |
| Show More |
For Research Use Only.
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction